PepRank

UC-II (undenatured type II collagen)

60%positive12 reports

Also: undenatured type 2 collagen · native type II collagen · chicken sternum collagen (undenatured) · in Move Free Ultra / Kirkland Triple Action Joint Health

CleanSupplementImmuneOral

40 mg/day chicken-cartilage collagen for knee arthritis pain via oral tolerance; slow, modest.

undenatured type II chicken-sternum collagen (native protein, not a defined peptide)

#4 of 23 supplements · updated
Access
Supplement
Cost / month
≈ €32
at 40 mg/day · Supersmart · €0.027/mg
OralFelt in 8–12 weeks

Builds over days or weeks of regular use rather than with each dose.

12 user reports
Glowing 1Positive 7Mixed 1Negative 3

  • r/rheumatoidarthritis· · 1 upvotesOriginal ↗

    type 2 collagen, and UC 2 has been the only thing that took my sacroiliac joint paint away.

    GlowingOral · sacroiliac joint pain

    rheumatoid arthritis forum; took type 2 collagen including UC-II

  • r/Supplements· · 5 upvotesOriginal ↗

    I am currently taking collagen UCII with boron and HA and I find it helps reduce flare ups and some of the daily chronic knee pain I have

    PositiveOral · chronic knee pain

    UC-II with boron and hyaluronic acid

  • r/Thritis· · 6 upvotesOriginal ↗

    I have rheumatoid arthritis and it appeared to make pain in my knee worse, which is counterintuitive.

    NegativeOral · rheumatoid arthritis

    person with rheumatoid arthritis

Users report
Users with knee or hip arthritis, sacroiliac or ankylosing-spondylitis pain mostly report fewer flare-ups and less daily ache after 1-3 months. One Move Free user says her hip pain returns whenever she misses a dose. Positive reports run about two in three. The standout negative pattern is a paradox: about a quarter say joints or the whole body ached more on it, including one person with rheumatoid arthritis and a Kirkland user whose elbow pain stopped within days of quitting. Strictly, it is a native protein rather than a peptide hydrolysate. Felt nothing: none of 12 reports said it did nothing, but 3 of 12 got worse; most reports come from arthritis forums.
Best effects
Less knee or hip arthritis pain · fewer flare-ups · less morning stiffness · small gains in knee range of motion (trials)
Downsides
Joint or whole-body aches in a minority · slow: judged after 8-12 weeks · often sold inside multi-ingredient blends, so the dose and effect are harder to judge
Evidence
Human RCTs — several RCTs at 40 mg/day (knee OA and activity-related knee pain), all funded by the ingredient owner (InterHealth/Lonza); the mechanism, oral tolerance via gut Peyer's patches, is mainly shown in animals
Caveat
The efficacy trials were sponsored by the ingredient's owner, and effects are modest. Labels mix the 40 mg ingredient weight with the ~10 mg of native collagen it supplies, which confuses dosing. A chicken-derived protein: avoid with chicken or egg allergy. In autoimmune arthritis a minority report more pain, so stop if joints worsen.
Typical use
40 mg/day (providing ~10 mg native type II collagen), traditionally on an empty stomach at bedtime; 3 months before judging.
Getting it
UC-II is a Lonza trademark sold as 40 mg capsules (NOW, Doctor's Best and others) and inside joint blends with hyaluronic acid and boron, such as Schiff Move Free Ultra Triple Action and Kirkland Triple Action Joint Health. Labels state either the 40 mg ingredient weight or the ~10 mg of native collagen it supplies.
Stacked with
Hydrolysed collagen peptides: different mechanism (building blocks vs immune tolerance); users often take both · boswellia (5-Loxin/ApresFlex): sold pre-combined for knee OA · omega-3: common pairing for inflammatory joint pain

User reports 12

  • r/rheumatoidarthritis· · 1 upvotesOriginal ↗

    type 2 collagen, and UC 2 has been the only thing that took my sacroiliac joint paint away.

    GlowingOral · sacroiliac joint pain

    rheumatoid arthritis forum; took type 2 collagen including UC-II

  • r/Supplements· · 5 upvotesOriginal ↗

    I am currently taking collagen UCII with boron and HA and I find it helps reduce flare ups and some of the daily chronic knee pain I have

    PositiveOral · chronic knee pain

    UC-II with boron and hyaluronic acid

  • r/ankylosingspondylitis· · 3 upvotesOriginal ↗

    I take UCII daily, but be careful to get the actual chicken origin and not marine. I also take high dose EPA and DHEA Omegas. This combo seems to help with the joint pain.

    PositiveOral · ankylosing spondylitis joint pain

    takes UC-II daily with high-dose omega-3; credits the combination

  • r/Menopause· · 2 upvotesOriginal ↗

    I take the Move Free Ultra every morning and if I miss it my hip starts hurting and I can hardly walk. It has collagen II in it.

    PositiveOral · hip pain

    takes Move Free Ultra (UC-II blend) daily; says it did nothing for her mother and other collagens did nothing for her

  • r/Thritis· · 2 upvotesOriginal ↗

    I take 20mg twice a day, and it really seemed to help what is highly likely arthritis in my knees. It's expensive tho

    Positive20 mg twice daily · Oral · probable knee arthritis

    UC-II powder, also taking hydrolysed chicken type II collagen

  • r/Biohackers· · 1 upvotesOriginal ↗

    Again, placebo is a wonderful thing, but after three weeks, the dull ache I have in my neck has subsided and my overall joint health feels better.

    PositiveOral · joint aches

    three weeks in; acknowledges placebo

  • r/fitness40plus· Original ↗

    The undenatured type 2 collagen is well supported by research, but it takes months to really make a difference. I also take a scoop of regular collagen peptide daily. These two have made a difference for me.

    PositiveOral · joints

    Kirkland Triple Action (UC-II + hyaluronic acid + boron) plus a scoop of collagen peptides daily

  • r/Supplements· Original ↗

    Two doctors recommended UC-II, and I also tried OrciRin C2 for some time. I felt a noticeable improvement, but it’s quite expensive.

    PositiveOral · knee cartilage wear

    25-year-old with X-ray cartilage wear; two doctors recommended UC-II; used OrciRin C2 (India)

  • r/Thritis· · 1 upvotesOriginal ↗

    I have been taking it for osteo in my hips and have been having less pain. I don't know if it is the UC2 or just the weather which has been nice and dry.

    MixedOral · hip osteoarthritis

    Member's Mark Triple Action (UC-II) for about 2 months

  • r/Thritis· · 6 upvotesOriginal ↗

    I have rheumatoid arthritis and it appeared to make pain in my knee worse, which is counterintuitive.

    NegativeOral · rheumatoid arthritis

    person with rheumatoid arthritis

  • r/Supplements· · 3 upvotesOriginal ↗

    Took it for 6 months and my elbows and tricep areas were in pain. I went to a physical therapist and they were completely baffled

    NegativeOral

    Kirkland joint supplement with type II collagen (UC-II) for 6 months; her father stopped the same product for leg pain

  • r/Thritis· · 1 upvotesOriginal ↗

    I tried some of the UC-II and felt my whole body just achy, not just joints

    NegativeOral

    arthritis forum

Safety

Tier by safety barStrict CleanBalanced CleanEvidence only Clean

Seen harmMechanismData gapSilent harmProduct

Seen harm 0/3
A 191-person RCT found safety no different from placebo; first-hand reports of worse joint pain, mostly in rheumatoid arthritis, resolved on stopping and are not serious. Lugo et al. 2016: UC-II vs glucosamine-chondroitin vs placebo, n=191 (PubMed 26822714) ↗r/Thritis: UC-II made my knee joint pain worse (rheumatoid arthritis) ↗
Mechanism 0/3
Works, if at all, by oral tolerance to type II collagen through gut lymphoid tissue; no pathway to serious harm is known.
Data gap 1/3
Self-affirmed GRAS (2009) with a clean toxicology package and RCTs of about 400 people in total, all funded by the ingredient owner. NutritionInsight 2009: UC-II self-determined GRAS ↗Marone et al. 2010: safety and toxicology of undenatured type II collagen (PubMed 20170336) ↗Lugo et al. 2016: UC-II vs glucosamine-chondroitin vs placebo, n=191 (PubMed 26822714) ↗
Silent harm 0/3
Joint aches, the only reported effect, are noticed within weeks and fade on stopping. r/Thritis: UC-II made my knee joint pain worse (rheumatoid arthritis) ↗
Product 0/3
An OTC capsule supplement or ingredient in joint blends from mainstream brands.
Never if
Chicken or egg allergy

Where to buy 1 in Europe · 3 total

ShopFormPricePer mgTesting
iHerbUScapsules · 4800 mg€44€9.25/gNo public tests
iHerbUScapsules · 2400 mg€24€9.96/gNo public tests
SupersmartEU · LUcapsules · 2400 mg€64€0.027/mgOwn COA

Studies 5

Sources 2

More in Recovery, joints & healing all 5 →

  1. 1Specific collagen peptides (Fortibone, Fortigel, Tendoforte, Verisol) CleanSupplement Oral≈ €13–25 / month51%positive25 reportsBranded collagen hydrolysates trialled for bone density, knee pain and tendons; safe, modest, slow.
  2. 2Mechano growth factor (MGF / PEG-MGF) Excluded Injection / Nasal≈ €27–110 / month53%positive5 reportsIGF-1 splice-variant peptide (plain or PEGylated) for muscle repair; disputed biology, cancer-cell signal.An unapproved growth-factor fragment with no human dosing data at all. The peptide drove prostate-cancer cell growth and metastasis in mice by a route that bypasses the IGF-1 receptor, and the pegylated form people buy has never been characterised.
  3. 3TB-500 / Thymosin beta-4 SDKPDMAEIEKFDKSKLKTETQEKNPLPSKETIEQEKQAGES (42 residues) Excluded Injection≈ €15–73 / month50%positive52 reportsHealing/actin peptide, almost always stacked with BPC; tumour-metastasis biology is a concern.Tβ4 has a well-documented pro-angiogenic and pro-metastatic role in cancer biology, and the fragment actually sold has no human safety data.
  4. 4BPC-157 GEPPPGKPADDAGLV (15 residues) Excluded Oral / Injection≈ €20–41 / month46%positive53 reportsThe most-loved healing peptide; strong anecdotes, animal-only data, angiogenesis concern.Pro-angiogenic mechanism with a plausible path to tumour growth and retinal neovascularisation, plus essentially no human safety data. HHS enforcement discretion (29 Oct 2026) is not a safety finding.

Sequence beads

Each bead is one amino acid in the peptide's chain, coloured by its side chain: grey for non-polar, cyan for polar, blue for positively charged and fuchsia for negatively charged. Length and mix tell related peptides apart at a glance, from a two-residue dipeptide like carnosine to a 43-residue protein like thymosin beta-4. The colours describe chemistry only and predict neither effect nor safety.

non-polarpolarpositivenegative

Report grades

Every first-hand Reddit or X report is graded on its own, from glowing through positive, mixed, nothing and negative to bad reaction, and the bar shows how those grades split. Posts that look vendor-adjacent stay on the peptide's page but are left out of the counts.

GlowingPositiveMixedNothingNegativeBad reaction

% positive

The share of a peptide's graded Reddit and X reports that are glowing or positive, vendor-adjacent posts left out. A peptide with few reports is pulled toward the average of all reports, as if it had eight average ones besides its own, so two glowing posts cannot top the list. Kept peptides rank by the same reports' mean grade, shrunk the same way, and excluded ones follow in that order.

Researcher estimate

No first-hand report of this peptide has been graded yet, so the figure is the researchers' own rating out of 10 from what they read about it. It ranks alongside the computed scores until reports arrive.

Safety tier

Each peptide is tiered clean, caution or excluded from its five risk axes under the chosen safety bar. An excluded peptide has a plausible route to serious harm, so it stays listed with the reason but ranks behind every other entry, however good its reviews.

Safety bar

The safety bar sets how much risk it takes to exclude a peptide. Strict: out on any serious mechanism with little human data, or any documented serious harm. Balanced: out on documented serious harm (unless it is obvious, reversible and from a regulated product), or a serious mechanism whose harm would be silent with no human data at all. Evidence only: out only on documented serious harm in humans that is lasting, delayed or from grey-market product.

Seen harm

Documented serious adverse events in humans, from 0 for none despite real exposure to 3 for deaths or several well-documented serious harms. Serious means a hospital or emergency visit or harm lasting weeks, so a headache or a bad night does not count.

Mechanism

A plausible biological route to serious harm at the doses people use, such as growth-factor signalling, hormone-axis suppression, heart or blood-pressure effects or immune activation. It runs from 0 when none is known to 3 when a dangerous pathway has been shown in living animals.

Data gap

How little human safety data exists for the molecule actually sold, from 0 for an approved drug with large trials and years of use to 3 for no human safety data at all. A modified analogue does not inherit its parent's trials.

Silent harm

Whether the feared harm would show quickly or stay hidden, from 0 when it is obvious and goes on stopping to 3 when it is silent and delayed, like tumour promotion or slow organ damage. User reports cannot reveal a harm that takes years to appear, so a high score here limits what good reviews can tell you.

Product

The risk of what people actually buy, from 0 for a regulated pharmacy or supplement product taken by mouth or on the skin to 3 for a grey-market injectable. In one dataset of 6,441 grey-market samples, 42–71% failed basic quality criteria and 15% carried endotoxin.

Evidence

The strongest kind of study behind the peptide's effects, from an approved drug through human controlled trials and small human studies to animal work or nothing of its own. Animal results often fail to carry over to people.

Access

How people get it: as an approved drug, a compounded prescription, an over-the-counter supplement or from the grey market, where nobody checks the vial. The channel decides both the legal position and the risk of a bad batch.

Price per month

Thirty days of the typical dose, from its low end to its high end, priced at the listing a careful buyer would choose: in stock, from a shop scoring 4 of 5 on trust (third-party tested where no score is set), failing that 3, a pure pack before a blend, a European shop first, then the cheapest per mg. The range is the dose's, not the shops'. A per-dose amount counts once a day unless the dose says otherwise. Prices are in euros at ECB rates of 2026-10-29, before shipping; the shop table keeps each listing's price per mg, per gram for bulk supplements. Where no listing can be priced the researchers' own estimate stands in, and says so.

Dose users report

The middle half of the daily doses stated in at least five first-hand reports, vendor posts left out. Where its middle sits more than twice above or below the declared dose, the month is priced at it as well, since what people take is what they pay for.

Testing

Whether the shop publishes lab results: third-party tested means an independent lab checks each batch, own COA means the shop's own certificate of analysis, and no public tests means neither. A certificate shows purity, not safety.

Added peptide

Some packs sold under one peptide's name hold a second one, such as 5 mg GHK-Cu in a nasal kit, stated only in the description. Sprayed in the nose or injected it reaches the blood like an injection, so it carries the risk of that route and is tiered as the injectable form, whatever its tier on the skin. A pack whose page gives no contents list may hold more than its name.