PepRank

Excluded

Peptides with a plausible route to serious harm under the strict safety bar, ranked by their user reports with the reason for each.

38 peptides

Safety barPositiveGrades

  1. 1GHRP-6 Excluded Hormones & libido Injection≈ €13–81 / month59%positive14 reportsFirst-generation GHRP used as an appetite drug for bulking; strong hunger, cortisol, glucose, GH axis.GH/IGF-1 axis elevation plus cortisol rise and reduced insulin sensitivity (FDA), with only single-dose human safety data.
  2. 2Kisspeptin YNWNSFGLRF (10 residues) Excluded Hormones & libido Nasal / Injection≈ €4.1–12 / month52%positive30 reportsTop-of-axis GnRH stimulator for libido/testosterone; chronic use can crash the axis.Directly manipulates the HPG axis; continuous or long-acting exposure suppresses it.
  3. 3Survodutide Excluded Metabolic & weight Injection≈ €36–140 / month56%positive24 reportsBoehringer's GLP-1/glucagon dual agonist: 12-13% weight loss and large liver-fat cuts in phase 3; unapproved.Unapproved drug bought as grey-market vials, usually stacked on tirzepatide: the GLP-1 class's pancreatitis, gallbladder and dehydration-kidney routes, a glucagon-driven heart-rate rise whose cardiovascular safety trial is still running, and GI effects harsh enough that about one in five phase 3 participants stopped.
  4. 4Mechano growth factor (MGF / PEG-MGF) Excluded Recovery, joints & healing Injection / Nasal≈ €27–110 / month53%positive5 reportsIGF-1 splice-variant peptide (plain or PEGylated) for muscle repair; disputed biology, cancer-cell signal.An unapproved growth-factor fragment with no human dosing data at all. The peptide drove prostate-cancer cell growth and metastasis in mice by a route that bypasses the IGF-1 receptor, and the pegylated form people buy has never been characterised.
  5. 5PE-22-28 GVSWGLR (7 residues) Excluded Mood & anxiety Nasal / Injection≈ €36–140 / month54%positive29 reportsTREK-1-blocking spadin fragment; fast-acting antidepressant in mice.No human data, and it blocks a channel whose loss makes animals more prone to seizures and ischaemic injury.
  6. 6Mazdutide Excluded Metabolic & weight Injection≈ €36–140 / month55%positive21 reportsGLP-1/glucagon dual agonist approved in China in 2025 (Xinermei); grey-market 'ghetto reta' with tirzepatide.Carries the GLP-1 class's serious-harm routes on its own label (pancreatitis, gallbladder disease, acute kidney injury, boxed warning for thyroid C-cell tumours in rodents) plus a glucagon-driven heart-rate rise; outside China it is bought as unregulated research vials and mostly stacked on tirzepatide, a combination no trial has tested.
  7. 7TB-500 / Thymosin beta-4 SDKPDMAEIEKFDKSKLKTETQEKNPLPSKETIEQEKQAGES (42 residues) Excluded Recovery, joints & healing Injection≈ €15–73 / month50%positive52 reportsHealing/actin peptide, almost always stacked with BPC; tumour-metastasis biology is a concern.Tβ4 has a well-documented pro-angiogenic and pro-metastatic role in cancer biology, and the fragment actually sold has no human safety data.
  8. 8GLP-1 agonists (semaglutide, tirzepatide, retatrutide) HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (31 residues) Excluded Metabolic & weight Injection≈ €27–1210 / month49%positive55 reportsMost effective weight-loss drugs ever; powerful systemic drugs, not 'clean' wellness peptides.Potent drugs with real serious-harm paths (pancreatitis, gallbladder, GI, heart rate, NAION). Worth it for obesity/diabetes under a doctor, but outside a 'clean general-health peptide' list.
  9. 9LL-37 [LL-37, 37 aa] (37 residues) Excluded Immune Topical / Injection≈ €45–110 / month53%positive26 reportsEndogenous antimicrobial peptide for chronic infections/dysbiosis; pro-inflammatory, pro-tumour in places.Pro-inflammatory/autoimmune and context-dependent pro-tumour activity, plus FDA-noted reproductive effects.
  10. 10Melanotan II DHFRWK (6 residues) Excluded Skin & hair Nasal / Injection≈ €27–54 / month51%positive51 reportsNon-selective melanocortin agonist for tanning; works, but has documented serious harms.Documented serious harms (melanoma reports, PRES, priapism) from non-selective melanocortin activation.
  11. 11Polaprezinc (zinc L-carnosine) AH (2 residues) ExcludedSupplement Gut Oral≈ €32 / month54%positive25 reportsJapanese ulcer drug sold as a supplement; the go-to oral 'stomach lining' option for gastritis.
  12. 12SS-31 RYKF (4 residues) Excluded Mitochondria & longevity Injection≈ €71–350 / month52%positive50 reportsMitochondrial cardiolipin binder; FDA-approved for Barth syndrome, popular for energy and endurance.
  13. 13Epitalon AEDG (4 residues) Excluded Mitochondria & longevity Injection≈ €41–82 / month48%positive54 reportsKhavinson 'longevity' tetrapeptide; users mainly report deeper sleep.Its claimed mechanism, telomerase activation, is a theoretical oncogenic path, and the data come from a single group.
  14. 14Dihexa YI (2 residues) Excluded Neuroprotection & repair Oral / Topical / Injection≈ €13–53 / month50%positive30 reportsAngiotensin-IV analogue claimed as potent synaptogenic; hyped, not evidenced in humans.Activates the oncogenic HGF/c-Met pathway, has no human safety data, and its foundational studies are under expressions of concern.
  15. 15Hexarelin Excluded Hormones & libido Injection≈ €27–110 / month45%positive5 reportsMost potent GHRP; fast desensitisation, acute cortisol/prolactin rise and direct CD36 heart effects.GH/IGF-1 axis elevation, acute cortisol and prolactin release, and GH-independent actions on heart and coronary vessels via CD36.
  16. 16GHK-Cu (injectable) GHK (3 residues) Excluded Skin & hair Injection≈ €20–40 / month50%positive30 reportsHugely popular for skin tightening and hair; supraphysiologic systemic dosing with no human data.Borderline: theoretical growth-factor/angiogenic signalling at supraphysiological systemic doses with no human injectable safety data. Topical GHK-Cu gives much of the skin benefit without this.
  17. 17Humanin MAPRGFSCLLLLTSEIDLPVKRRA (24 residues) Excluded Neuroprotection & repair Injection43%positive1 reportsMitochondrial-derived cytoprotective peptide; anti-Alzheimer's in animals only.Its anti-apoptotic action helps glioma cells survive chemotherapy in animal studies, and there is no human data.
  18. 18BPC-157 GEPPPGKPADDAGLV (15 residues) Excluded Recovery, joints & healing Oral / Injection≈ €20–41 / month46%positive53 reportsThe most-loved healing peptide; strong anecdotes, animal-only data, angiogenesis concern.Pro-angiogenic mechanism with a plausible path to tumour growth and retinal neovascularisation, plus essentially no human safety data. HHS enforcement discretion (29 Oct 2026) is not a safety finding.
  19. 19IGF-1 DES Excluded Hormones & libido Injection≈ €22–180 / month49%positive4 reportsShort-acting, truncated IGF-1 injected into the trained muscle; very potent at dropping blood sugar.An IGF-1 receptor agonist about ten times as potent as IGF-1 in cells and the most hypoglycaemic of the IGF-1 variants in primates, with no human data, the same tumour-promotion concern as LR3, and grey-market vials that are rarely tested.
  20. 20MK-677 Excluded Hormones & libido Oral≈ €18–54 / month48%positive29 reportsOral GH secretagogue (not a peptide); hunger, bloat, insulin resistance, CHF signal.GH/IGF-1 elevation, insulin resistance and a CHF safety signal in an RCT.
  21. 21PTD-DBM Excluded Skin & hair Topical≈ €36–90 / month42%positive6 reportsWnt-activating hair-regrowth peptide from mouse studies; DIY users report little.It works by switching on Wnt/beta-catenin signalling in skin, and sustained beta-catenin activation causes hair-follicle tumours in mice and pilomatricoma in humans. It has no human safety data, and users pair it with valproic acid, a teratogen.
  22. 22Plecanatide Excluded Gut Oral≈ €540–650 / month45%positive25 reportsApproved uroguanylin-like GC-C agonist tablet for constipation and IBS-C; linaclotide's sibling.The label warns of severe diarrhoea (0.6-1% in trials, most within the first days) with instructions to stop and rehydrate, and Reddit users describe days of watery diarrhoea leaving them badly dehydrated. Its sibling linaclotide has post-marketing hospitalisations for the same harm. It is obvious and stops when the drug does, so under a doctor it is a reasonable constipation treatment, but it is a real route to serious harm and does not belong on a clean wellness list.
  23. 23FGL EVYVVAENQQGKSKA (15 residues) Excluded Neuroprotection & repair Nasal / Injection43%positive1 reportsNCAM mimetic that activates FGF receptors; rodent memory data only.Agonist of the mitogenic FGF receptor, with only phase-1 data and no users to learn from.
  24. 24Follistatin-344 Excluded Hormones & libido Injection≈ €180–450 / month44%positive10 reportsMyostatin/activin-binding protein sold as 1 mg vials; about half of tested vials held no follistatin.Blocks myostatin and activin signalling (FSH axis, angiogenesis, glucose) with no human safety data for the injected protein; vials often hold other drugs.
  25. 25IGF-1 LR3 Excluded Hormones & libido Injection≈ €36–140 / month40%positive24 reportsLong-acting IGF-1 analogue (a cell-culture reagent) for muscle; hypoglycaemia, tumour-growth signal.A potent, long-acting IGF-1 receptor agonist with no human data at all: it accelerated tumour growth in mice, the same receptor causes hypoglycaemic seizures and carries a malignancy warning on the approved IGF-1 drug, and every vial is grey-market.
  26. 26Linaclotide Excluded Gut Oral≈ €450 / month45%positive25 reportsApproved gut-only GC-C agonist pill for IBS-C and constipation; works for many, often too well.The label warns of severe diarrhoea (2% in trials), and post-marketing reports describe dehydration with fainting, low blood pressure and low potassium or sodium that needed IV fluids or hospital, plus rare anaphylaxis and angioedema. The harm is obvious at once and stops when the drug does, so under a doctor it is a reasonable IBS-C treatment, but it is a real route to serious harm and does not belong on a clean wellness list.
  27. 27Sermorelin YADAIFTNSYRKVLGQLSARKLLQDIMSR (29 residues) Excluded Hormones & libido Sublingual / Injection≈ €38–94 / month46%positive29 reportsShort GHRH analogue; cheap, gentle, sleep-focused, still GH/IGF-1 axis.GH/IGF-1 axis elevation, though the mildest of the class.
  28. 28PT-141 DHFRWK (6 residues) Excluded Hormones & libido Nasal / Injection≈ €24–170 / month39%positive30 reportsFDA-approved melanocortin libido drug; works strongly for many, raises blood pressure.Cardiovascular effects (BP spikes; contraindicated in CVD) and melanocortin pigmentation effects.
  29. 29GHRP-2 Excluded Hormones & libido Injection / Nasal / IV≈ €18–45 / month39%positive7 reportsJapan-approved GH diagnostic sold as a vial; hunger, cortisol and prolactin spikes, GH axis.GH/IGF-1 axis elevation with cortisol and prolactin spikes; FDA notes raised insulin needs and deaths in critically ill subjects.
  30. 30MOTS-c MRWQEMGYIFYPRKLR (16 residues) Excluded Metabolic & weight Injection≈ €22–88 / month42%positive52 reportsMitochondrial AMPK-activating peptide; vivid endurance anecdotes, allergic sensitisation reports.Borderline: recurring reports of allergic sensitisation and anaphylaxis-like events, plus no human data on the native peptide at the doses used.
  31. 31Cerebrolysin Excluded Neuroprotection & repair Nasal / Injection / IV≈ €140–540 / month40%positive29 reportsPig-brain peptide mix for stroke/TBI; strong anecdotes, real safety questions.Cochrane found more non-fatal serious adverse events than placebo; animal-derived injectable with allergy/immune reaction risk.
  32. 32Tesamorelin YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 residues) Excluded Metabolic & weight Injection≈ €240–480 / month43%positive29 reportsFDA-approved GHRH analogue for visceral fat; raises IGF-1, anaphylaxis reports.GH/IGF-1 axis elevation (neoplasm and glucose warnings on label) plus anaphylaxis reports.
  33. 33Ipamorelin Excluded Hormones & libido Injection≈ €11–100 / month42%positive51 reportsSelective ghrelin-receptor GH secretagogue; sleep and recovery, GH axis plus reactions.GH/IGF-1 axis elevation plus repeated anaphylaxis reports, including a coroner-attributed death.
  34. 34Cagrilintide Excluded Metabolic & weight Injection≈ €27–110 / month36%positive25 reportsNovo's weekly amylin analogue, the 'cagri' in CagriSema; a hard appetite brake, often with heavy fatigue.Unapproved drug bought as grey-market vials and usually stacked on retatrutide or tirzepatide outside any trial: gallbladder disease and fast lean-mass loss, severe hypoglycaemia if combined with insulin (amylin class), days of not eating from dosing errors with home-reconstituted vials, and a pH-sensitive peptide sold in plain powder.
  35. 35Corticotropin (repository ACTH gel) Excluded Neuroprotection & repair Injection43%positive15 reportsPituitary hormone gel approved for MS relapses; works like steroids, costs like a luxury car.Drives the adrenals to flood the body with cortisol, so it carries the corticosteroid label warnings (infection, Cushing's syndrome, adrenal insufficiency on withdrawal, GI perforation, psychosis, high blood pressure and glucose, bone loss) plus anaphylaxis. A prescription relapse treatment under a neurologist, not something to take outside one.
  36. 36CJC-1295 YADAIFTQSYRKVLAQLSARKLLQDILSR (29 residues) Excluded Hormones & libido Injection≈ €14–27 / month38%positive29 reportsLong-acting GHRH analogue stacked with ipamorelin; GH axis, vasodilatory reactions.GH/IGF-1 axis elevation plus FDA-noted tachycardia/vasodilatory reactions and anaphylaxis.
  37. 37Glatiramer acetate Excluded Neuroprotection & repair Injection37%positive24 reportsApproved MS drug made of random myelin-mimicking peptide chains; modest relapse cut, injection burden.Prescription immunomodulator for relapsing MS with an FDA boxed warning for anaphylaxis (82 cases, 6 deaths reported to 2024, some years into treatment), plus label warnings for liver injury and skin necrosis. Worth it for MS under a neurologist; not a self-directed peptide.
  38. 38Orexin-A (intranasal) EPLPDCCRQKTCSCRLYELLHGAGNHAAGILTL (33 residues) Excluded Focus & memory Nasal1/10estimateWake-promoting neuropeptide; tiny narcolepsy studies, no consumer track record.Essentially untested, with sympathetic activation and no reliable product.

Sequence beads

Each bead is one amino acid in the peptide's chain, coloured by its side chain: grey for non-polar, cyan for polar, blue for positively charged and fuchsia for negatively charged. Length and mix tell related peptides apart at a glance, from a two-residue dipeptide like carnosine to a 43-residue protein like thymosin beta-4. The colours describe chemistry only and predict neither effect nor safety.

non-polarpolarpositivenegative

Report grades

Every first-hand Reddit or X report is graded on its own, from glowing through positive, mixed, nothing and negative to bad reaction, and the bar shows how those grades split. Posts that look vendor-adjacent stay on the peptide's page but are left out of the counts.

GlowingPositiveMixedNothingNegativeBad reaction

% positive

The share of a peptide's graded Reddit and X reports that are glowing or positive, vendor-adjacent posts left out. A peptide with few reports is pulled toward the average of all reports, as if it had eight average ones besides its own, so two glowing posts cannot top the list. Kept peptides rank by the same reports' mean grade, shrunk the same way, and excluded ones follow in that order.

Researcher estimate

No first-hand report of this peptide has been graded yet, so the figure is the researchers' own rating out of 10 from what they read about it. It ranks alongside the computed scores until reports arrive.

Safety tier

Each peptide is tiered clean, caution or excluded from its five risk axes under the chosen safety bar. An excluded peptide has a plausible route to serious harm, so it stays listed with the reason but ranks behind every other entry, however good its reviews.

Safety bar

The safety bar sets how much risk it takes to exclude a peptide. Strict: out on any serious mechanism with little human data, or any documented serious harm. Balanced: out on documented serious harm (unless it is obvious, reversible and from a regulated product), or a serious mechanism whose harm would be silent with no human data at all. Evidence only: out only on documented serious harm in humans that is lasting, delayed or from grey-market product.

Seen harm

Documented serious adverse events in humans, from 0 for none despite real exposure to 3 for deaths or several well-documented serious harms. Serious means a hospital or emergency visit or harm lasting weeks, so a headache or a bad night does not count.

Mechanism

A plausible biological route to serious harm at the doses people use, such as growth-factor signalling, hormone-axis suppression, heart or blood-pressure effects or immune activation. It runs from 0 when none is known to 3 when a dangerous pathway has been shown in living animals.

Data gap

How little human safety data exists for the molecule actually sold, from 0 for an approved drug with large trials and years of use to 3 for no human safety data at all. A modified analogue does not inherit its parent's trials.

Silent harm

Whether the feared harm would show quickly or stay hidden, from 0 when it is obvious and goes on stopping to 3 when it is silent and delayed, like tumour promotion or slow organ damage. User reports cannot reveal a harm that takes years to appear, so a high score here limits what good reviews can tell you.

Product

The risk of what people actually buy, from 0 for a regulated pharmacy or supplement product taken by mouth or on the skin to 3 for a grey-market injectable. In one dataset of 6,441 grey-market samples, 42–71% failed basic quality criteria and 15% carried endotoxin.

Evidence

The strongest kind of study behind the peptide's effects, from an approved drug through human controlled trials and small human studies to animal work or nothing of its own. Animal results often fail to carry over to people.

Access

How people get it: as an approved drug, a compounded prescription, an over-the-counter supplement or from the grey market, where nobody checks the vial. The channel decides both the legal position and the risk of a bad batch.

Price per month

Thirty days of the typical dose, from its low end to its high end, priced at the listing a careful buyer would choose: in stock, from a shop scoring 4 of 5 on trust (third-party tested where no score is set), failing that 3, a pure pack before a blend, a European shop first, then the cheapest per mg. The range is the dose's, not the shops'. A per-dose amount counts once a day unless the dose says otherwise. Prices are in euros at ECB rates of 2026-10-29, before shipping; the shop table keeps each listing's price per mg, per gram for bulk supplements. Where no listing can be priced the researchers' own estimate stands in, and says so.

Dose users report

The middle half of the daily doses stated in at least five first-hand reports, vendor posts left out. Where its middle sits more than twice above or below the declared dose, the month is priced at it as well, since what people take is what they pay for.

Testing

Whether the shop publishes lab results: third-party tested means an independent lab checks each batch, own COA means the shop's own certificate of analysis, and no public tests means neither. A certificate shows purity, not safety.

Added peptide

Some packs sold under one peptide's name hold a second one, such as 5 mg GHK-Cu in a nasal kit, stated only in the description. Sprayed in the nose or injected it reaches the blood like an injection, so it carries the risk of that route and is tiered as the injectable form, whatever its tier on the skin. A pack whose page gives no contents list may hold more than its name.