PepRank

Clean peptides, ranked

Peptides ranked by what the people who took them report, with any that carry a plausible route to serious harm listed last.

85 peptides · 2215 user reports graded · 32 shops priced · updated 2026-10-30

Ranking

Goal
Kind
Route
Show
Onset
Cost
Sort
Safety bar

SequenceGradesScoreTier

  1. 1KPV KPV (3 residues) Caution Gut Oral / Topical / Injectionfrom €2.87/mg7/1047 reportsAnti-inflammatory alpha-MSH fragment for gut, skin and allergy inflammation; animal data only.
  2. 2Selank TKPRPGP (7 residues) Caution Mood & anxiety Nasal / Injectionfrom €0.75/mg7/1048 reportsNon-sedating anxiolytic; quiets rumination and social anxiety without benzo-style dependence.
  3. 3Collagen peptides (oral) CleanSupplement Skin & hair Oralfrom €0.036/g6/1047 reportsFood-grade protein; modest, slow, inconsistent benefits for skin, nails and joints.
  4. 4GHK-Cu (topical) GHK (3 residues) CautionSupplement Skin & hair Topicalfrom €0.17/mg6/1044 reportsDecades-old cosmetic copper peptide; gentle skin firmness/texture and possibly hair benefits.
  5. 5Semax MEHFPGP (7 residues) Caution Focus & memory Nasal / Injectionfrom €0.75/mg6/1051 reportsMild non-stimulant focus and mental-stamina aid; used for stroke recovery in Russia.
  6. 6Specific collagen peptides (Fortibone, Fortigel, Tendoforte, Verisol) CleanSupplement Recovery, joints & healing Oralfrom €0.25/g6/1025 reportsBranded collagen hydrolysates trialled for bone density, knee pain and tendons; safe, modest, slow.
  7. 7UC-II (undenatured type II collagen) CleanSupplement Recovery, joints & healing Oralfrom €0.027/mg6/1012 reports40 mg/day chicken-cartilage collagen for knee arthritis pain via oral tolerance; slow, modest.
  8. 8AHK-Cu (topical) AHK (3 residues) CautionSupplement Skin & hair Topicalfrom €0.40/mg6/1020 reportsGHK-Cu's hair-targeted sibling; scalp serum users report baby hairs, but data stop at a dish.
  9. 9ARA-290 QEQLERALNSS (11 residues) Caution Recovery, joints & healing Injectionfrom €5.50/mg6/1040 reportsNon-erythropoietic EPO-derived peptide for small-fibre neuropathy pain.
  10. 10GB-115 GW (2 residues) Caution Mood & anxiety Nasal / Sublingual / Oral6/1041 reportsDipeptide-like CCK-receptor blocker; daytime anxiolytic without sedation or blunting.
  11. 11Glutathione ECG (3 residues) CautionSupplement Mitochondria & longevity Oral / Injection / IVfrom €1.99/g6/1048 reportsMaster antioxidant tripeptide; oral raises stores modestly, injections popular for skin glow.
  12. 12N-Acetyl Semax Amidate MEHFPGP (7 residues) Caution Focus & memory Nasal / Injectionfrom €1.05/mg6/1048 reportsStabilised, stronger, longer-acting Semax; same use (focus, mental energy).
  13. 13EGF serum (sh-oligopeptide-1) CautionSupplement Skin & hair Topical6/1024 reportsRecombinant human growth factor in serums; users like the glow, but keep it off broken or microneedled skin.
  14. 14Thymosin alpha-1 SDAAVDTSSEITTKDLKEKKEVVEEAEN (28 residues) Caution Immune Injectionfrom €4.49/mg6/1047 reportsThymic immunomodulator approved abroad for hepatitis B/C; used to cut down on colds.
  15. 15Adamax MEHFPGP (7 residues) Caution Focus & memory Nasal / Injectionfrom €4.49/mg6/1028 reportsVendor-invented adamantyl Semax variant; stronger, longer focus per users.A novel molecule with no published animal or human safety data, sold only by grey-market vendors.
  16. 16VIP HSDAVFTDNYTRLRKQMAVKKYLNSILN (28 residues) Caution Immune Nasal / IV6/1030 reportsPotent vasodilating neuropeptide used in mould-illness (CIRS) protocols under a doctor.Significant cardiovascular action (vasodilation/hypotension) and broad immunomodulation; a supervised CIRS therapy, not a general-health peptide.
  17. 17Bovine colostrum CautionSupplement Gut Oralfrom €0.93/g5.5/1024 reportsCow's first milk: immunoglobulins, lactoferrin and growth-factor peptides for gut lining and fewer colds.
  18. 18Biotinoyl tripeptide-1 (Procapil) & Capixyl hair serums GHK (3 residues) CautionSupplement Skin & hair Topical5/1025 reportsCosmetic anti-shedding peptides in cheap leave-on scalp serums; a minority see baby hairs.
  19. 19Lactium (alpha-s1 casein hydrolysate) YLGYLEQLLR (10 residues) CleanSupplement Sleep Oral5/1011 reportsMilk-protein decapeptide for stress and sleep; gentle, non-sedating, slow to build.
  20. 20Larazotide GGVLVQPG (8 residues) Clean Gut Oralfrom €4.66/mg5/106 reportsTight-junction (zonulin) blocker trialled for celiac; very safe, but efficacy failed phase 3.
  21. 21Matrixyl (palmitoyl pentapeptide-4) KTTKS (5 residues) CleanSupplement Skin & hair Topicalfrom €2.00/mg5/1021 reportsThe classic 'collagen-signal' cosmetic peptide; slow, soft smoothing, more hydration than lift.
  22. 22SYN-AKE (dipeptide diaminobutyroyl benzylamide diacetate) CautionSupplement Skin & hair Topical5/1018 reportsSynthetic 'snake venom' peptide for expression lines; mostly a K-beauty sheet-mask ingredient, mild at best.
  23. 23Argireline (acetyl hexapeptide-8) EEMQRR (6 residues) CautionSupplement Skin & hair Topical5/1025 reportsSNAP-25-mimic 'topical Botox' for expression lines; real but mild softening for about half of users.
  24. 24DSIP WAGGDASGE (9 residues) Caution Sleep Nasal / Injectionfrom €2.15/mg5/1049 reportsSleep-architecture peptide; some feel deeper, more restful sleep, many feel nothing.
  25. 25Lactotripeptides (VPP and IPP) VPP (3 residues) CautionSupplement Metabolic & weight Oral5/104 reportsFermented-milk ACE-inhibitor tripeptides; lower blood pressure by a few mmHg, best data in Japan.
  26. 26N-Acetyl Selank Amidate TKPRPGP (7 residues) Caution Mood & anxiety Nasal / Injectionfrom €2.00/mg5/1021 reportsStabilised, stronger Selank variant for anxiety; less data, more side reports.
  27. 27Noopept CautionPeptide-derived Focus & memory Nasal / Sublingual / Oralfrom €1.34/g5/1050 reportsDipeptide-derived racetam-like nootropic; mild focus and creativity aid, cheap.
  28. 28Oxytocin (intranasal) CYIQNPCLG (9 residues) Caution Mood & anxiety Nasalfrom €3.50/mg5/1050 reportsBrief social warmth and lower social anxiety; subtle, short-lived for most.
  29. 29Pinealon EDR (3 residues) Caution Sleep Oral / Injectionfrom €0.21/mg5/1046 reportsKhavinson tripeptide 'bioregulator'; sleep and circadian claims, mixed reports.
  30. 30Thymalin Caution Immune Injectionfrom €2.49/mg5/1012 reportsRussian thymus-extract bioregulator for immune 'renewal' in older people; thin evidence.
  31. 31Thymulin Caution Immune Injection / Topical5/104 reportsZinc-bound thymic nonapeptide; injected for immunity, sprayed on scalps for hair. 1980s data only.
  32. 325-Amino-1MQ Caution Metabolic & weight Oral / Injectionfrom €2.39/mg5/1028 reportsSmall-molecule NNMT inhibitor sold alongside peptides for fat loss and energy; no human data.Novel systemic enzyme inhibitor with zero human safety data; unknown long-term metabolic and methylation effects.
  33. 33Cortexin Caution Focus & memory Injectionfrom €1.10/mg5/1020 reportsRussian brain-cortex extract, Cerebrolysin cousin; 10-day IM courses.Animal-brain extract given by injection: immune/allergic and theoretical prion risk, and it shares Cerebrolysin's SAE signal.
  34. 34Carnosine AH (2 residues) CleanSupplement Focus & memory Oralfrom €0.80/g4/1015 reportsDietary antioxidant dipeptide; small memory benefits in elderly trials, mild if any.
  35. 35SNAP-8 (acetyl octapeptide-3) EEMQRRAD (8 residues) Caution Skin & hair Topicalfrom €2.55/mg4/1012 reportsArgireline's longer sibling, mostly DIY-mixed from peptide vials; users rarely see more than argireline.
  36. 36AOD-9604 YLRIVQCRSVEGSCGF (16 residues) Caution Metabolic & weight Oral / Injectionfrom €5.98/mg4/1026 reportsGH C-terminal fragment that failed obesity trials; safe-looking but doesn't work.
  37. 37Chonluten Caution Immune Oral / Injection4/101 reportsKhavinson's 'bronchial' tripeptide EDG; no airway study exists, and only one first-hand report was found.
  38. 38HGH Fragment 176-191 Caution Metabolic & weight Injection / Nasal4/1014 reportsGrowth-hormone tail fragment sold for fat loss; AOD-9604's near-twin, untested in humans and rarely felt.
  39. 39Nonapeptide-1 (Melanostatine 5) CautionSupplement Skin & hair Topical4/1012 reportsAlpha-MSH blocker for dark spots, always sold beside stronger lighteners; its own effect is untested.
  40. 40P21 (P021) DGGL (4 residues) Caution Focus & memory Nasal / Oral / Injection4/1015 reportsCNTF-derived neurogenic peptide from Alzheimer's mouse work; grey market only.No human safety data; deliberately drives neurogenesis via a growth-factor pathway, and products are of uncertain identity.
  41. 41Hexapeptide-9 (Collaxyl) CautionSupplement Skin & hair Topical3/10Collagen-sequence 'signal' peptide in firming serums; tested in people only as a modified or enhanced version.
  42. 42Leuphasyl (pentapeptide-18) CautionSupplement Skin & hair Topical3/101 reportsEnkephalin-mimic expression-line peptide, sold as argireline's partner; hard to find alone, barely reviewed.
  43. 43Tripeptide-10 citrulline (Decorinyl) CautionSupplement Skin & hair Topical3/10Decorin-mimic peptide meant to tidy collagen fibres; one tiny randomised trial, no user reports.
  44. 44Cerluten CautionSupplement Focus & memory Oral3/10Khavinson oral calf-brain peptide extract (Cytomax A-5); one in-house report, no first-hand users found.
  45. 45Tricomin CautionSupplement Skin & hair Topical3/101 reports1990s ProCyte copper-peptide hair spray, now an AHK-Cu cosmetic; one unpublished small trial, users shrug.
  46. 46Visoluten CautionSupplement Mitochondria & longevity Oral3/102 reportsKhavinson oral eye-tissue peptide extract (Cytomax A-11); one in-house report, users notice little.
  47. 47NAP / Davunetide NAPVSIPQ (8 residues) Clean Focus & memory Nasal2/10ADNP-derived microtubule-stabilising peptide; safe in a large trial but ineffective.
  48. Excluded
  49. 48GLP-1 agonists (semaglutide, tirzepatide, retatrutide) HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (31 residues) Excluded Metabolic & weight Injectionfrom €2.21/mg9/1055 reportsMost effective weight-loss drugs ever; powerful systemic drugs, not 'clean' wellness peptides.Potent drugs with real serious-harm paths (pancreatitis, gallbladder, GI, heart rate, NAION). Worth it for obesity/diabetes under a doctor, but outside a 'clean general-health peptide' list.
  50. 49BPC-157 GEPPPGKPADDAGLV (15 residues) Excluded Recovery, joints & healing Oral / Injectionfrom €1.93/mg8/1053 reportsThe most-loved healing peptide; strong anecdotes, animal-only data, angiogenesis concern.Pro-angiogenic mechanism with a plausible path to tumour growth and retinal neovascularisation, plus essentially no human safety data. HHS enforcement discretion (29 Oct 2026) is not a safety finding.
  51. 50GHK-Cu (injectable) GHK (3 residues) Excluded Skin & hair Injectionfrom €0.40/mg8/1030 reportsHugely popular for skin tightening and hair; supraphysiologic systemic dosing with no human data.Borderline: theoretical growth-factor/angiogenic signalling at supraphysiological systemic doses with no human injectable safety data. Topical GHK-Cu gives much of the skin benefit without this.
  52. 51Melanotan II DHFRWK (6 residues) Excluded Skin & hair Nasal / Injectionfrom €3.50/mg8/1051 reportsNon-selective melanocortin agonist for tanning; works, but has documented serious harms.Documented serious harms (melanoma reports, PRES, priapism) from non-selective melanocortin activation.
  53. 52Mazdutide Excluded Metabolic & weight Injection7/1021 reportsGLP-1/glucagon dual agonist approved in China in 2025 (Xinermei); grey-market 'ghetto reta' with tirzepatide.Carries the GLP-1 class's serious-harm routes on its own label (pancreatitis, gallbladder disease, acute kidney injury, boxed warning for thyroid C-cell tumours in rodents) plus a glucagon-driven heart-rate rise; outside China it is bought as unregulated research vials and mostly stacked on tirzepatide, a combination no trial has tested.
  54. 53MOTS-c MRWQEMGYIFYPRKLR (16 residues) Excluded Metabolic & weight Injectionfrom €2.00/mg7/1052 reportsMitochondrial AMPK-activating peptide; vivid endurance anecdotes, allergic sensitisation reports.Borderline: recurring reports of allergic sensitisation and anaphylaxis-like events, plus no human data on the native peptide at the doses used.
  55. 54PT-141 DHFRWK (6 residues) Excluded Hormones & libido Nasal / Injectionfrom €1.13/mg7/1030 reportsFDA-approved melanocortin libido drug; works strongly for many, raises blood pressure.Cardiovascular effects (BP spikes; contraindicated in CVD) and melanocortin pigmentation effects.
  56. 55Survodutide Excluded Metabolic & weight Injection7/1024 reportsBoehringer's GLP-1/glucagon dual agonist: 12-13% weight loss and large liver-fat cuts in phase 3; unapproved.Unapproved drug bought as grey-market vials, usually stacked on tirzepatide: the GLP-1 class's pancreatitis, gallbladder and dehydration-kidney routes, a glucagon-driven heart-rate rise whose cardiovascular safety trial is still running, and GI effects harsh enough that about one in five phase 3 participants stopped.
  57. 56TB-500 / Thymosin beta-4 SDKPDMAEIEKFDKSKLKTETQEKNPLPSKETIEQEKQAGES (42 residues) Excluded Recovery, joints & healing Injectionfrom €3.39/mg7/1052 reportsHealing/actin peptide, almost always stacked with BPC; tumour-metastasis biology is a concern.Tβ4 has a well-documented pro-angiogenic and pro-metastatic role in cancer biology, and the fragment actually sold has no human safety data.
  58. 57Tesamorelin YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 residues) Excluded Metabolic & weight Injectionfrom €5.99/mg7/1029 reportsFDA-approved GHRH analogue for visceral fat; raises IGF-1, anaphylaxis reports.GH/IGF-1 axis elevation (neoplasm and glucose warnings on label) plus anaphylaxis reports.
  59. 58Polaprezinc (zinc L-carnosine) AH (2 residues) ExcludedSupplement Gut Oralfrom €7.11/g6/1025 reportsJapanese ulcer drug sold as a supplement; the go-to oral 'stomach lining' option for gastritis.
  60. 59SS-31 RYKF (4 residues) Excluded Mitochondria & longevity Injectionfrom €2.37/mg6/1050 reportsMitochondrial cardiolipin binder; FDA-approved for Barth syndrome, popular for energy and endurance.
  61. 60Cagrilintide Excluded Metabolic & weight Injection6/1025 reportsNovo's weekly amylin analogue, the 'cagri' in CagriSema; a hard appetite brake, often with heavy fatigue.Unapproved drug bought as grey-market vials and usually stacked on retatrutide or tirzepatide outside any trial: gallbladder disease and fast lean-mass loss, severe hypoglycaemia if combined with insulin (amylin class), days of not eating from dosing errors with home-reconstituted vials, and a pH-sensitive peptide sold in plain powder.
  62. 61Cerebrolysin Excluded Focus & memory Nasal / Injection / IVfrom €1.05/mg6/1029 reportsPig-brain peptide mix for stroke/TBI; strong anecdotes, real safety questions.Cochrane found more non-fatal serious adverse events than placebo; animal-derived injectable with allergy/immune reaction risk.
  63. 62CJC-1295 YADAIFTQSYRKVLAQLSARKLLQDILSR (29 residues) Excluded Hormones & libido Injectionfrom €4.54/mg6/1029 reportsLong-acting GHRH analogue stacked with ipamorelin; GH axis, vasodilatory reactions.GH/IGF-1 axis elevation plus FDA-noted tachycardia/vasodilatory reactions and anaphylaxis.
  64. 63Epitalon AEDG (4 residues) Excluded Mitochondria & longevity Injectionfrom €1.59/mg6/1054 reportsKhavinson 'longevity' tetrapeptide; users mainly report deeper sleep.Its claimed mechanism, telomerase activation, is a theoretical oncogenic path, and the data come from a single group.
  65. 64GHRP-6 Excluded Hormones & libido Injection6/1014 reportsFirst-generation GHRP used as an appetite drug for bulking; strong hunger, cortisol, glucose, GH axis.GH/IGF-1 axis elevation plus cortisol rise and reduced insulin sensitivity (FDA), with only single-dose human safety data.
  66. 65Ipamorelin Excluded Hormones & libido Injectionfrom €1.13/mg6/1051 reportsSelective ghrelin-receptor GH secretagogue; sleep and recovery, GH axis plus reactions.GH/IGF-1 axis elevation plus repeated anaphylaxis reports, including a coroner-attributed death.
  67. 66Kisspeptin YNWNSFGLRF (10 residues) Excluded Hormones & libido Nasal / Injectionfrom €3.50/mg6/1030 reportsTop-of-axis GnRH stimulator for libido/testosterone; chronic use can crash the axis.Directly manipulates the HPG axis; continuous or long-acting exposure suppresses it.
  68. 67Linaclotide Excluded Gut Oral6/1025 reportsApproved gut-only GC-C agonist pill for IBS-C and constipation; works for many, often too well.The label warns of severe diarrhoea (2% in trials), and post-marketing reports describe dehydration with fainting, low blood pressure and low potassium or sodium that needed IV fluids or hospital, plus rare anaphylaxis and angioedema. The harm is obvious at once and stops when the drug does, so under a doctor it is a reasonable IBS-C treatment, but it is a real route to serious harm and does not belong on a clean wellness list.
  69. 68Plecanatide Excluded Gut Oral6/1025 reportsApproved uroguanylin-like GC-C agonist tablet for constipation and IBS-C; linaclotide's sibling.The label warns of severe diarrhoea (0.6-1% in trials, most within the first days) with instructions to stop and rehydrate, and Reddit users describe days of watery diarrhoea leaving them badly dehydrated. Its sibling linaclotide has post-marketing hospitalisations for the same harm. It is obvious and stops when the drug does, so under a doctor it is a reasonable constipation treatment, but it is a real route to serious harm and does not belong on a clean wellness list.
  70. 69Sermorelin YADAIFTNSYRKVLGQLSARKLLQDIMSR (29 residues) Excluded Hormones & libido Sublingual / Injectionfrom €5.50/mg6/1029 reportsShort GHRH analogue; cheap, gentle, sleep-focused, still GH/IGF-1 axis.GH/IGF-1 axis elevation, though the mildest of the class.
  71. 70Corticotropin (repository ACTH gel) Excluded Immune Injection5/1015 reportsPituitary hormone gel approved for MS relapses; works like steroids, costs like a luxury car.Drives the adrenals to flood the body with cortisol, so it carries the corticosteroid label warnings (infection, Cushing's syndrome, adrenal insufficiency on withdrawal, GI perforation, psychosis, high blood pressure and glucose, bone loss) plus anaphylaxis. A prescription relapse treatment under a neurologist, not something to take outside one.
  72. 71Dihexa YI (2 residues) Excluded Focus & memory Oral / Topical / Injectionfrom €0.14/mg5/1030 reportsAngiotensin-IV analogue claimed as potent synaptogenic; hyped, not evidenced in humans.Activates the oncogenic HGF/c-Met pathway, has no human safety data, and its foundational studies are under expressions of concern.
  73. 72Glatiramer acetate Excluded Immune Injection5/1024 reportsApproved MS drug made of random myelin-mimicking peptide chains; modest relapse cut, injection burden.Prescription immunomodulator for relapsing MS with an FDA boxed warning for anaphylaxis (82 cases, 6 deaths reported to 2024, some years into treatment), plus label warnings for liver injury and skin necrosis. Worth it for MS under a neurologist; not a self-directed peptide.
  74. 73Hexarelin Excluded Hormones & libido Injection5/105 reportsMost potent GHRP; fast desensitisation, acute cortisol/prolactin rise and direct CD36 heart effects.GH/IGF-1 axis elevation, acute cortisol and prolactin release, and GH-independent actions on heart and coronary vessels via CD36.
  75. 74IGF-1 LR3 Excluded Hormones & libido Injection5/1024 reportsLong-acting IGF-1 analogue (a cell-culture reagent) for muscle; hypoglycaemia, tumour-growth signal.A potent, long-acting IGF-1 receptor agonist with no human data at all: it accelerated tumour growth in mice, the same receptor causes hypoglycaemic seizures and carries a malignancy warning on the approved IGF-1 drug, and every vial is grey-market.
  76. 75MK-677 Excluded Hormones & libido Oral5/1029 reportsOral GH secretagogue (not a peptide); hunger, bloat, insulin resistance, CHF signal.GH/IGF-1 elevation, insulin resistance and a CHF safety signal in an RCT.
  77. 76PE-22-28 GVSWGLR (7 residues) Excluded Mood & anxiety Nasal / Injectionfrom €4.99/mg5/1029 reportsTREK-1-blocking spadin fragment; fast-acting antidepressant in mice.No human data, and it blocks a channel whose loss makes animals more prone to seizures and ischaemic injury.
  78. 77Follistatin-344 Excluded Hormones & libido Injection4/1010 reportsMyostatin/activin-binding protein sold as 1 mg vials; about half of tested vials held no follistatin.Blocks myostatin and activin signalling (FSH axis, angiogenesis, glucose) with no human safety data for the injected protein; vials often hold other drugs.
  79. 78GHRP-2 Excluded Hormones & libido Injection / Nasal / IV4/107 reportsJapan-approved GH diagnostic sold as a vial; hunger, cortisol and prolactin spikes, GH axis.GH/IGF-1 axis elevation with cortisol and prolactin spikes; FDA notes raised insulin needs and deaths in critically ill subjects.
  80. 79IGF-1 DES Excluded Hormones & libido Injection4/104 reportsShort-acting, truncated IGF-1 injected into the trained muscle; very potent at dropping blood sugar.An IGF-1 receptor agonist about ten times as potent as IGF-1 in cells and the most hypoglycaemic of the IGF-1 variants in primates, with no human data, the same tumour-promotion concern as LR3, and grey-market vials that are rarely tested.
  81. 80LL-37 [LL-37, 37 aa] (37 residues) Excluded Immune Topical / Injectionfrom €12/mg4/1026 reportsEndogenous antimicrobial peptide for chronic infections/dysbiosis; pro-inflammatory, pro-tumour in places.Pro-inflammatory/autoimmune and context-dependent pro-tumour activity, plus FDA-noted reproductive effects.
  82. 81Mechano growth factor (MGF / PEG-MGF) Excluded Recovery, joints & healing Injection / Nasal4/105 reportsIGF-1 splice-variant peptide (plain or PEGylated) for muscle repair; disputed biology, cancer-cell signal.An unapproved growth-factor fragment with no human dosing data at all. The peptide drove prostate-cancer cell growth and metastasis in mice by a route that bypasses the IGF-1 receptor, and the pegylated form people buy has never been characterised.
  83. 82PTD-DBM Excluded Skin & hair Topical3/106 reportsWnt-activating hair-regrowth peptide from mouse studies; DIY users report little.It works by switching on Wnt/beta-catenin signalling in skin, and sustained beta-catenin activation causes hair-follicle tumours in mice and pilomatricoma in humans. It has no human safety data, and users pair it with valproic acid, a teratogen.
  84. 83FGL EVYVVAENQQGKSKA (15 residues) Excluded Focus & memory Nasal / Injection1/101 reportsNCAM mimetic that activates FGF receptors; rodent memory data only.Agonist of the mitogenic FGF receptor, with only phase-1 data and no users to learn from.
  85. 84Humanin MAPRGFSCLLLLTSEIDLPVKRRA (24 residues) Excluded Mitochondria & longevity Injection1/101 reportsMitochondrial-derived cytoprotective peptide; anti-Alzheimer's in animals only.Its anti-apoptotic action helps glioma cells survive chemotherapy in animal studies, and there is no human data.
  86. 85Orexin-A (intranasal) EPLPDCCRQKTCSCRLYELLHGAGNHAAGILTL (33 residues) Excluded Focus & memory Nasal1/10Wake-promoting neuropeptide; tiny narcolepsy studies, no consumer track record.Essentially untested, with sympathetic activation and no reliable product.

Categories

Body

Immune 8

Gut 6

Skin & hair 17

Mitochondria & longevity 5

Recovery, joints & healing 6

Metabolic & weight 10

Hormones & libido 12

Sequence beads

Each bead is one amino acid in the peptide's chain, coloured by its side chain: grey for non-polar, cyan for polar, blue for positively charged and fuchsia for negatively charged. Length and mix tell related peptides apart at a glance, from a two-residue dipeptide like carnosine to a 43-residue protein like thymosin beta-4. The colours describe chemistry only and predict neither effect nor safety.

non-polarpolarpositivenegative

Report grades

Every first-hand Reddit or X report is graded on its own, from glowing through positive, mixed, nothing and negative to bad reaction, and the bar shows how those grades split. Posts that look vendor-adjacent stay on the peptide's page but are left out of the counts.

GlowingPositiveMixedNothingNegativeBad reaction

User score

The overall rating out of 10 across the threads people wrote about the peptide, counting those who felt nothing as well as those who liked it. Kept peptides are ranked by it, and excluded ones follow in the same order.

Safety tier

Each peptide is tiered clean, caution or excluded from its five risk axes under the chosen safety bar. An excluded peptide has a plausible route to serious harm, so it stays listed with the reason but ranks behind every other entry, however good its reviews.

Safety bar

The safety bar sets how much risk it takes to exclude a peptide. Strict: out on any serious mechanism with little human data, or any documented serious harm. Balanced: out on documented serious harm (unless it is obvious, reversible and from a regulated product), or a serious mechanism whose harm would be silent with no human data at all. Evidence only: out only on documented serious harm in humans that is lasting, delayed or from grey-market product.

Seen harm

Documented serious adverse events in humans, from 0 for none despite real exposure to 3 for deaths or several well-documented serious harms. Serious means a hospital or emergency visit or harm lasting weeks, so a headache or a bad night does not count.

Mechanism

A plausible biological route to serious harm at the doses people use, such as growth-factor signalling, hormone-axis suppression, heart or blood-pressure effects or immune activation. It runs from 0 when none is known to 3 when a dangerous pathway has been shown in living animals.

Data gap

How little human safety data exists for the molecule actually sold, from 0 for an approved drug with large trials and years of use to 3 for no human safety data at all. A modified analogue does not inherit its parent's trials.

Silent harm

Whether the feared harm would show quickly or stay hidden, from 0 when it is obvious and goes on stopping to 3 when it is silent and delayed, like tumour promotion or slow organ damage. User reports cannot reveal a harm that takes years to appear, so a high score here limits what good reviews can tell you.

Product

The risk of what people actually buy, from 0 for a regulated pharmacy or supplement product taken by mouth or on the skin to 3 for a grey-market injectable. In one dataset of 6,441 grey-market samples, 42–71% failed basic quality criteria and 15% carried endotoxin.

Evidence

The strongest kind of study behind the peptide's effects, from an approved drug through human controlled trials and small human studies to animal work or nothing of its own. Animal results often fail to carry over to people.

Access

How people get it: as an approved drug, a compounded prescription, an over-the-counter supplement or from the grey market, where nobody checks the vial. The channel decides both the legal position and the risk of a bad batch.

Price per mg

Each listing's price divided by the milligrams it holds, in euros at ECB rates of 2026-10-29 and before shipping, so vials of different sizes compare directly. Bulk supplements cheaper than a cent a milligram show per gram, and the ranking shows the cheapest European listing.

Testing

Whether the shop publishes lab results: third-party tested means an independent lab checks each batch, own COA means the shop's own certificate of analysis, and no public tests means neither. A certificate shows purity, not safety.