PepRank

Mazdutide

55%positive21 reports

Also: Xinermei (信尔美) · IBI362 · LY3305677 · 'maz' / 'mazdu'

ExcludedInjection

GLP-1/glucagon dual agonist approved in China in 2025 (Xinermei); grey-market 'ghetto reta' with tirzepatide.

#30 of 61 research peptides · updated
Onset
Appetite and sugar cravings drop within the first one or two doses for some users; trial weight loss accrues over months.
Lasts
Once-weekly injection; half-life about 10 days, so effects and side effects linger after stopping (the label asks women to stop 3 months before trying to conceive).
Access
Grey market
Cost / month
≈ €36–140
researchers' estimate; no listing to price
21 user reports
Positive 12Mixed 4Nothing 1Negative 3Bad reaction 1

  • r/Mazdutide· · 9 upvotesOriginal ↗

    I’m on Tirz/Maz now and it works for me as I’m now close to target. Zero sides.

    PositiveInjection

    with tirzepatide, after trying survodutide

  • r/Mazdutide· · 8 upvotesOriginal ↗

    Everything I've read said Survo should deliver better results than Maz, but in my personal subjective experience, nothing has shed pounds more effectively than the stack of Tirz with Maz.

    Positiveup to 3 mg/week with 10 mg tirzepatide · Injection

  • r/Mazdutide· · 5 upvotesOriginal ↗

    It also gave me such bad heart palpitations and my resting heart rate was like 130 that I thought i was going to need to go to the ER a few times.

    Bad reactionstarted at 3 mg instead of 1.5 mg · Injection

    grey-market vial after months on other GLP-1s

Strict case
Carries the GLP-1 class's serious-harm routes on its own label (pancreatitis, gallbladder disease, acute kidney injury, boxed warning for thyroid C-cell tumours in rodents) plus a glucagon-driven heart-rate rise; outside China it is bought as unregulated research vials and mostly stacked on tirzepatide, a combination no trial has tested.
Users report
Twenty-two first-hand reports, nearly all mazdutide added to tirzepatide (the 'ghetto reta' stack) by people stalled on a GLP-1. Twelve are good (a thirteenth, from a coach's account, is flagged as vendor-adjacent): stalls broken, 'powered through the last 25 lbs', more energy, and several prefer it to survodutide as gentler on the gut and heart rate. Two US trial participants describe food noise gone and better blood pressure and lipids. Complaints are nausea and sleepiness in week one, diarrhoea at 6 mg, insomnia, a higher resting heart rate, dizziness from falling blood pressure, one case of emotional numbness, and one person who started at 3 mg and had palpitations with a resting rate near 130. Reports are few and confounded by tirzepatide. Felt nothing: 1 of 22 reports felt nothing; one US trial participant lost only 23 lb in five months at 10 mg..
Best effects
Weight loss of 14% at 48 weeks (6 mg) and 17% at 60 weeks (9 mg) in Chinese phase 3 trials · liver-fat, triglyceride, uric-acid and blood-pressure reductions beyond weight loss · appetite and sugar-craving suppression · users report more energy than on tirzepatide alone
Downsides
Vomiting, nausea and diarrhoea (53%, 47% and 39% at 9 mg in GLORY-2) · higher resting heart rate, mostly during dose escalation · insomnia · dizziness or fatigue as blood pressure falls · injection-site and allergic reactions (7-8% and 3-5% in GLORY-1)
Watch
Acute pancreatitis and acute gallbladder disease (label warnings; obstructive pancreatitis and cholecystitis in GLORY-1) · Thyroid C-cell tumours in rodents at clinically relevant exposure (boxed warning); contraindicated with MTC or MEN 2 · Heart-rate increase from glucagon-receptor agonism (mean up to 4.6 bpm; sinus tachycardia 4.5% at 6 mg vs 2.9%) · Acute kidney injury from dehydration with severe GI effects (label); label says stop if resting heart rate stays raised · Label also warns of aspiration under anaesthesia and asks for monitoring of depression and suicidal thoughts (class precaution) · Stacking on tirzepatide doubles GLP-1 load in an untested combination; vials of unknown dose and purity
Evidence
Approved drug — approved in China (NMPA, June 2025 for weight management, September 2025 for type 2 diabetes) on phase 3 GLORY and DREAMS trials in Chinese adults; Lilly's US phase 2 (n=179) has posted results; not FDA- or EMA-approved
Caveat
Almost all efficacy data come from young Chinese adults (mean age about 34) with modest baseline weight, and only the 9 mg trial ran past 48 weeks. The 2.6-4.6 bpm heart-rate rise eased during maintenance in trials, but users stacking it on tirzepatide report larger rises. Dose response is steep: 4 mg and 16 mg are very different drugs.
Typical use
China label: 2 mg weekly for 4 weeks, then 4 mg, then 6 mg if needed after at least 4 more weeks; maintenance 4 or 6 mg once weekly (a 9 mg dose was filed in November 2025). Lilly's US phase 2 went up to 16 mg. Grey-market users: 1-2 mg start, 3-5 mg weekly beside 5-15 mg tirzepatide. Users report 340–710 mcg/day (median 570 mcg, n=7).
Getting it
A prescription drug in China (Xinermei pre-filled pens, launched July 2025); elsewhere sold as research vials, mostly 5-10 mg, shipped from Hong Kong or China and paid in crypto.
Stacked with
Tirzepatide: The 'ghetto reta' stack, adding glucagon agonism to GLP-1/GIP; the commonest use outside China, never trialled. · cagrilintide: Occasionally added for appetite, making a four-receptor stack. · retatrutide: Not combined; users switch between them, since retatrutide already includes glucagon agonism.

User reports 22

  • r/Mazdutide· · 9 upvotesOriginal ↗

    I’m on Tirz/Maz now and it works for me as I’m now close to target. Zero sides.

    PositiveInjection

    with tirzepatide, after trying survodutide

  • r/Mazdutide· · 8 upvotesOriginal ↗

    Everything I've read said Survo should deliver better results than Maz, but in my personal subjective experience, nothing has shed pounds more effectively than the stack of Tirz with Maz.

    Positiveup to 3 mg/week with 10 mg tirzepatide · Injection

  • r/Mazdutide· · 6 upvotesOriginal ↗

    I changed to mazdu and had appetite suppression again, plus I’m seeing faster weight loss.

    Positive5 mg/week with 10 mg tirzepatide · Injection

    slow responder; retatrutide had increased their appetite

  • r/Mazdutide· · 4 upvotesOriginal ↗

    Maz was like Reta-lite and, combined with Tirz, just powered through the last 25 lbs I needed to lose.

    PositiveInjection

    with tirzepatide

  • r/Mazdutide· · 3 upvotesOriginal ↗

    I’ve got Survo on hand but I’ve stuck with Maz since it’s working and gives me energy.

    PositiveInjection

  • r/Mazdutide· · 3 upvotesOriginal ↗

    I broke a major stall by switching from Reta to Tirz+maz. More energy too. No negative side effects.

    Positive1 mg rising to 5 mg/week with 7.5-10 mg tirzepatide · Injection

    switched from 8 mg retatrutide that had stalled for 6 weeks

  • r/Biohacking· · 3 upvotesOriginal ↗

    It works very well and is kind of mild too. Running it with Tirzepatide right now and loving it.

    Positive1.5 mg/week rising by 1 mg every 4 weeks, with 5 mg tirzepatide · Injection

  • r/Mazdutide· · 2 upvotesOriginal ↗

    I was plateaued at max tirz dose for around 3 months and now the scale is finally moving. Ive lost around 5 lbs since starting maz.

    Positive1 mg rising to 3 mg/week with 15 mg tirzepatide · Injection · about 2.5 months

    has atrial fibrillation; resting heart rate no worse than on tirzepatide alone, quit retatrutide over heart rate

  • r/survodutide· · 2 upvotesOriginal ↗

    I titrated up to 10 when I added Maz. Maz is not as “strong” as Survo but there is no reason to to titrate down. Some RS do reduce their tirz. I got to target weight in 10 weeks after adding Maz.

    PositiveInjection

    added to tirzepatide titrated to 10 mg

  • r/Mazdutide· · 2 upvotesOriginal ↗

    I am.. 2 shots in on maz ans sugar cravings. have stopped. Appetite suppression is back

    PositiveInjection · 2 doses

  • r/Mazdutide· · 2 upvotesOriginal ↗

    Health metrics have definitely improved across the board in addition to the weight loss. BP, glucose, cholesterol are well in normal range. My BP is definitely in the normal range now, although my resting HR is slightly higher than pre-trial.

    PositiveInjection

    US clinical-trial participant

  • r/Mazdutide· · 1 upvotesOriginal ↗

    Over 1.5 years I tried many suppliers and I only had good results from a couple and others not so much. Using these for maintenance and control. They work for me.

    Positive0.1 mg every 8 days rising to 0.5 mg over a year · Injection · 1 year

  • r/Mazdutide· · 4 upvotesOriginal ↗

    I spent 3 months titrating up and now 3 months at 10mg. I feel good, but I’m not really seeing much weight loss overall. I’m down about 23 lbs since starting in June.

    Mixedescalated to 10 mg/week · Injection · about 5 months

    US clinical-trial participant (doses 1.5 to 10 mg)

  • r/Biohacking· · 1 upvotesOriginal ↗

    I just finished my first month on mazdu. First week has been tough ( nausea, sleepiness) but body adjusted to it. Now this week I’m starting 4 mg

    MixedInjection · 1 month

    later switched to retatrutide after moving from China, where pre-filled mazdutide pens were easy to get

  • r/GLP1ResearchTalk· · 1 upvotesOriginal ↗

    I went with Mazdutide as a stack with my Tirzepatide for a while to combat Tirz fatigue and add the glucagon effect. It worked well but I started to have trouble sleeping so I stopped it.

    Mixedup to 3 mg/week with 6-7 mg tirzepatide · Injection

  • r/Mazdutide· · 1 upvotesOriginal ↗

    Got up to 6 mg/wk of maz + 7.5 tirz and kaboom..huge diarrhea. So dropped back to 4 mg maz and 6 mg tirz, seemed to have broken my stall at least lost 6 lbs in 3 weeks.

    Mixed2-6 mg/week, settled at 4 mg with 6 mg tirzepatide · Injection

    could not tolerate survodutide at all

  • r/Mazdutide· · 2 upvotesOriginal ↗

    I’ve tried both and definitely prefer the Tirz/survo stack. Maz did nothing for me.

    NothingInjection

    long-term GLP-1 user; preferred tirzepatide plus survodutide

  • r/BiohackingU· · 2 upvotesOriginal ↗

    I finished a 1 month change to mazdutide, I hated it. It's the only GLP that made me feel emotionless, numb and made my ADHD worse in the time being.

    NegativeInjection · 1 month

  • r/Mazdutide· · 2 upvotesOriginal ↗

    Mine wasn’t particularly high before I started so I’m definitely experiencing some annoying dizziness/fatigue etc.

    Negative1.5 mg/week · Injection

  • r/Mazdutide· · 1 upvotesOriginal ↗

    mazdutide tends to raise my resting heart rate quite a bit, at least for now. This also happened to me with Reta, perhaps to a slightly lesser extent, however.

    Negative1.5-2 mg/week · Injection · 1 week

  • r/Mazdutide· · 5 upvotesOriginal ↗

    It also gave me such bad heart palpitations and my resting heart rate was like 130 that I thought i was going to need to go to the ER a few times.

    Bad reactionstarted at 3 mg instead of 1.5 mg · Injection

    grey-market vial after months on other GLP-1s

  • r/Mazdutide· · 5 upvotesOriginal ↗

    It's very good. I've been running that with a few of my clients for the past 10 weeks. I've seen better results than with Cagri-Sema and that's saying a lot

    Positivevendor-adjacent

    mazdutide plus cagrilintide run on "clients" by the account TheSARMS_Coach

Safety

Tier by safety barStrict ExcludedBalanced ExcludedEvidence only Excluded

Seen harmMechanismData gapSilent harmProduct

Seen harm 2/3
The Chinese label (2025) carries warnings for acute pancreatitis, acute gallbladder disease, severe GI reactions, acute kidney injury and sustained heart-rate rise, and the trials produced matching cases: one gallstone-induced obstructive pancreatitis and one acute cholecystitis on mazdutide in GLORY-1 (gallstones 2.0% vs 1.0%), severe GI reactions in 2.0%, and one acute cholecystitis at 16 mg in Lilly's US phase 2. No deaths reported. On Reddit, one user starting at double the label dose described palpitations with a resting rate near 130. Xinermei (mazdutide) Chinese prescribing information ↗Ji et al. 2025, GLORY-1 (NEJM) ↗NCT06124807 posted results (Lilly phase 2, serious adverse events) ↗
Mechanism 3/3
The molecule itself caused thyroid C-cell adenomas and carcinomas in a 2-year rat study at exposures below the human dose (boxed warning; human relevance unknown), and as a GLP-1 receptor agonist it shares the class's in-human pancreatitis and gallbladder harms. Glucagon-receptor agonism adds a heart-rate rise (mean up to 4.6 bpm in escalation, 2.6 bpm at 48 weeks; sinus tachycardia 4.5% at 6 mg vs 2.9%). Xinermei label: carcinogenicity and warnings ↗Ji et al. 2025, GLORY-1 full text (heart rate, sinus tachycardia) ↗
Data gap 1/3
Approved in China (NMPA, June and September 2025) on phase 3 trials with about 2,000 participants (GLORY-1, GLORY-2, DREAMS-1, DREAMS-2), plus Lilly's 179-person US phase 2. Not approved by a stringent regulator, post-marketing experience is about a year and almost all trial participants were young Chinese adults; no data on stacking it with tirzepatide, which is how grey-market users take it. Innovent: NMPA approval for chronic weight management (June 2025) ↗Gao et al. 2026, GLORY-2 (JAMA) ↗
Silent harm 3/3
The feared harm the mechanism points at includes thyroid C-cell tumours, which would be silent and delayed; under the rubric a theoretical tumour pathway scores 3. The other harms are mixed: pancreatitis and cholecystitis present acutely, while gallstones and a raised resting heart rate build up unnoticed without imaging or a monitor. Xinermei label: boxed warning, thyroid C-cell tumour risk ↗
Product 3/3
In China it is a pharmacy pre-filled pen, but outside China what people buy is grey-market lyophilised vials shipped from Hong Kong or China, reconstituted at home and stacked on tirzepatide. Users report supplier-to-supplier differences in effect, and the dose is set by the vendor's label claim. Mendias & Awan 2026 preprint: grey-market peptide quality ↗FDA: concerns with unapproved GLP-1 drugs used for weight loss ↗r/Mazdutide: results varied by supplier over 1.5 years ↗
Never if
Personal or family history of medullary thyroid carcinoma or MEN 2 (label) · Pregnancy, planned pregnancy within 3 months, or breastfeeding (label) · Known hypersensitivity to mazdutide or its excipients (label) · History of acute gallbladder disease or severe GI disease such as gastroparesis (not recommended on the label) · History of pancreatitis · Tachyarrhythmias, atrial fibrillation or other conditions where a higher resting heart rate is dangerous · History of suicidal thoughts or attempts (label advises avoiding it) · Under 18

Studies 5

Sources 6

More in Metabolic & weight all 10 →

  1. 1AOD-9604 YLRIVQCRSVEGSCGF (16 residues) Caution Oral / Injection≈ €45–90 / month53%positive26 reportsGH C-terminal fragment that failed obesity trials; safe-looking but doesn't work.
  2. 2Lactotripeptides (VPP and IPP) VPP (3 residues) CautionSupplement Oral≈ €15–35 / month49%positive4 reportsFermented-milk ACE-inhibitor tripeptides; lower blood pressure by a few mmHg, best data in Japan.
  3. 35-Amino-1MQ Caution Oral / Injection≈ €72–1440 / month41%positive28 reportsSmall-molecule NNMT inhibitor sold alongside peptides for fat loss and energy; no human data.Novel systemic enzyme inhibitor with zero human safety data; unknown long-term metabolic and methylation effects.
  4. 4HGH Fragment 176-191 Caution Injection / Nasal≈ €27–72 / month40%positive14 reportsGrowth-hormone tail fragment sold for fat loss; AOD-9604's near-twin, untested in humans and rarely felt.
  5. 5Survodutide Excluded Injection≈ €36–140 / month56%positive24 reportsBoehringer's GLP-1/glucagon dual agonist: 12-13% weight loss and large liver-fat cuts in phase 3; unapproved.Unapproved drug bought as grey-market vials, usually stacked on tirzepatide: the GLP-1 class's pancreatitis, gallbladder and dehydration-kidney routes, a glucagon-driven heart-rate rise whose cardiovascular safety trial is still running, and GI effects harsh enough that about one in five phase 3 participants stopped.
  6. 6GLP-1 agonists (semaglutide, tirzepatide, retatrutide) HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (31 residues) Excluded Injection≈ €27–1210 / month49%positive55 reportsMost effective weight-loss drugs ever; powerful systemic drugs, not 'clean' wellness peptides.Potent drugs with real serious-harm paths (pancreatitis, gallbladder, GI, heart rate, NAION). Worth it for obesity/diabetes under a doctor, but outside a 'clean general-health peptide' list.
  7. 7MOTS-c MRWQEMGYIFYPRKLR (16 residues) Excluded Injection≈ €22–88 / month42%positive52 reportsMitochondrial AMPK-activating peptide; vivid endurance anecdotes, allergic sensitisation reports.Borderline: recurring reports of allergic sensitisation and anaphylaxis-like events, plus no human data on the native peptide at the doses used.
  8. 8Tesamorelin YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL (44 residues) Excluded Injection≈ €240–480 / month43%positive29 reportsFDA-approved GHRH analogue for visceral fat; raises IGF-1, anaphylaxis reports.GH/IGF-1 axis elevation (neoplasm and glucose warnings on label) plus anaphylaxis reports.
  9. 9Cagrilintide Excluded Injection≈ €27–110 / month36%positive25 reportsNovo's weekly amylin analogue, the 'cagri' in CagriSema; a hard appetite brake, often with heavy fatigue.Unapproved drug bought as grey-market vials and usually stacked on retatrutide or tirzepatide outside any trial: gallbladder disease and fast lean-mass loss, severe hypoglycaemia if combined with insulin (amylin class), days of not eating from dosing errors with home-reconstituted vials, and a pH-sensitive peptide sold in plain powder.

Sequence beads

Each bead is one amino acid in the peptide's chain, coloured by its side chain: grey for non-polar, cyan for polar, blue for positively charged and fuchsia for negatively charged. Length and mix tell related peptides apart at a glance, from a two-residue dipeptide like carnosine to a 43-residue protein like thymosin beta-4. The colours describe chemistry only and predict neither effect nor safety.

non-polarpolarpositivenegative

Report grades

Every first-hand Reddit or X report is graded on its own, from glowing through positive, mixed, nothing and negative to bad reaction, and the bar shows how those grades split. Posts that look vendor-adjacent stay on the peptide's page but are left out of the counts.

GlowingPositiveMixedNothingNegativeBad reaction

% positive

The share of a peptide's graded Reddit and X reports that are glowing or positive, vendor-adjacent posts left out. A peptide with few reports is pulled toward the average of all reports, as if it had eight average ones besides its own, so two glowing posts cannot top the list. Kept peptides rank by the same reports' mean grade, shrunk the same way, and excluded ones follow in that order.

Researcher estimate

No first-hand report of this peptide has been graded yet, so the figure is the researchers' own rating out of 10 from what they read about it. It ranks alongside the computed scores until reports arrive.

Safety tier

Each peptide is tiered clean, caution or excluded from its five risk axes under the chosen safety bar. An excluded peptide has a plausible route to serious harm, so it stays listed with the reason but ranks behind every other entry, however good its reviews.

Safety bar

The safety bar sets how much risk it takes to exclude a peptide. Strict: out on any serious mechanism with little human data, or any documented serious harm. Balanced: out on documented serious harm (unless it is obvious, reversible and from a regulated product), or a serious mechanism whose harm would be silent with no human data at all. Evidence only: out only on documented serious harm in humans that is lasting, delayed or from grey-market product.

Seen harm

Documented serious adverse events in humans, from 0 for none despite real exposure to 3 for deaths or several well-documented serious harms. Serious means a hospital or emergency visit or harm lasting weeks, so a headache or a bad night does not count.

Mechanism

A plausible biological route to serious harm at the doses people use, such as growth-factor signalling, hormone-axis suppression, heart or blood-pressure effects or immune activation. It runs from 0 when none is known to 3 when a dangerous pathway has been shown in living animals.

Data gap

How little human safety data exists for the molecule actually sold, from 0 for an approved drug with large trials and years of use to 3 for no human safety data at all. A modified analogue does not inherit its parent's trials.

Silent harm

Whether the feared harm would show quickly or stay hidden, from 0 when it is obvious and goes on stopping to 3 when it is silent and delayed, like tumour promotion or slow organ damage. User reports cannot reveal a harm that takes years to appear, so a high score here limits what good reviews can tell you.

Product

The risk of what people actually buy, from 0 for a regulated pharmacy or supplement product taken by mouth or on the skin to 3 for a grey-market injectable. In one dataset of 6,441 grey-market samples, 42–71% failed basic quality criteria and 15% carried endotoxin.

Evidence

The strongest kind of study behind the peptide's effects, from an approved drug through human controlled trials and small human studies to animal work or nothing of its own. Animal results often fail to carry over to people.

Access

How people get it: as an approved drug, a compounded prescription, an over-the-counter supplement or from the grey market, where nobody checks the vial. The channel decides both the legal position and the risk of a bad batch.

Price per month

Thirty days of the typical dose, from its low end to its high end, priced at the listing a careful buyer would choose: in stock, from a shop scoring 4 of 5 on trust (third-party tested where no score is set), failing that 3, a pure pack before a blend, a European shop first, then the cheapest per mg. The range is the dose's, not the shops'. A per-dose amount counts once a day unless the dose says otherwise. Prices are in euros at ECB rates of 2026-10-29, before shipping; the shop table keeps each listing's price per mg, per gram for bulk supplements. Where no listing can be priced the researchers' own estimate stands in, and says so.

Dose users report

The middle half of the daily doses stated in at least five first-hand reports, vendor posts left out. Where its middle sits more than twice above or below the declared dose, the month is priced at it as well, since what people take is what they pay for.

Testing

Whether the shop publishes lab results: third-party tested means an independent lab checks each batch, own COA means the shop's own certificate of analysis, and no public tests means neither. A certificate shows purity, not safety.

Added peptide

Some packs sold under one peptide's name hold a second one, such as 5 mg GHK-Cu in a nasal kit, stated only in the description. Sprayed in the nose or injected it reaches the blood like an injection, so it carries the risk of that route and is tiered as the injectable form, whatever its tier on the skin. A pack whose page gives no contents list may hold more than its name.